PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pbr040068.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Maleae; Pyrus
Family GRF
Protein Properties Length: 528aa    MW: 56722 Da    PI: 7.1353
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pbr040068.1genomeCPETRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC77.41.4e-24142185144
          WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                  d+epgrC+RtDGKkWRCsr+v +++k+CErH+hrgr rsrk++e
  Pbr040068.1 142 DPEPGRCKRTDGKKWRCSRDVAPDQKYCERHMHRGRPRSRKHVE 185
                  79****************************************98 PP

2QLQ561.2e-1981114235
          QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                  +FT+aQ+ +L++Q+++yKy++a++PvP +Ll+++
  Pbr040068.1  81 PFTNAQWKELERQAMIYKYMVASLPVPRDLLFPL 114
                  8******************************998 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009517.0E-1080116IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166620.72381116IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.8E-1381114IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166725.586142186IPR014977WRC domain
PfamPF088791.6E-20143185IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 528 aa     Download sequence    Send to blast
MMMVHHDNHR RPFPSSDTTP VPDAGGPTCN RPPPTYDDVV AAGTGTGSSS GGGAVLRNLQ  60
PFDIRTNTRS AGGMTTSFGF PFTNAQWKEL ERQAMIYKYM VASLPVPRDL LFPLTTTPPG  120
TTAASQSPLG GRFNLRLSNS TDPEPGRCKR TDGKKWRCSR DVAPDQKYCE RHMHRGRPRS  180
RKHVEVHATA ASKRVRHDIN LAPPLPTVSP ETVSISNPAN GINKNVCSSQ FMGSNLHPYH  240
PSPVFPERDS AKFASFESMN SASANREPRN LDWLVMKGEP VSDAQWHQLM HSKTELSTKI  300
PFFDPNSSVF SNRSEEESFL NLNSFTNFSA GEDQQDGGEC NLFLNPDVAP LESPLLEETP  360
RYFIDAWSKT VTDEETMAAN SVNNNDNSSA PSSGQLSPSS LTLSMGGYNS INEEMGQTQM  420
SLGTSGNGMM PRGSTWPASW VASAPGGPLA EVLKPTTSAA SNPSSPVTTG TTTNGELGSP  480
LAVSSPSGVL QKKFVSPSDS SGNSSPTLAS SKAKPENVSL WLNQSKA*
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009361294.10.0PREDICTED: growth-regulating factor 6
TrEMBLM5XKV00.0M5XKV0_PRUPE; Uncharacterized protein
STRINGVIT_16s0098g01080.t011e-126(Vitis vinifera)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF73242842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.13e-35growth-regulating factor 7